$ loading_
Run AlphaFold3 protein predictions, variant batches, and job monitoring via Docker.
Copy the install command and let the AI configure it · recommended for beginners
No copy-paste install info for "AlphaFold3 MCP Server" yet — see the docs or source repo.
Use the AlphaFold3 MCP Server to submit a structure prediction job for this protein sequence, and return the job ID, key parameters, and expected run status: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG.
Returns the submitted prediction job details, including job ID, input summary, run configuration, and current status.
Use the AlphaFold3 MCP Server to batch submit structure predictions for these protein variants: WT, A23V, G45D, R78K. Then summarize each job status and compare potential structural differences versus the wild type.
Outputs a batch job list, per-variant statuses, and a research-oriented summary of structural differences.
Check the run status of job IDs AF3-2025-001 and AF3-2025-002 in the AlphaFold3 MCP Server, indicate whether they are completed or failed, and provide next-step recommendations.
Returns job progress and error notes, with recommendations to retry, download results, or keep waiting.
Query AlphaFold and biomedical sources through a local knowledge graph.
Design proteins, predict folding and affinity, and extend drug R&D analyses.
Query UniProt data for proteins, sequences, variants, diseases, and related research.
Annotate genetic variants and predict functional effects via the Ensembl VEP API.
Access PDBe to query protein structures and retrieve structural biology data.
Control PyMOL with natural language for protein structure analysis and visualization.